PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010932189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 525aa    MW: 58262.3 Da    PI: 4.5592
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010932189.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.2e-53371632128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtdeelv +yLk+kv +++l+l  +i +vd+yk+ePw+Lp k  +k+++k+wyfFs+rd+ky++g+r+nr+tk+gyWk+tgkd+++ +
  XP_010932189.1  37 PPGFRFHPTDEELVLYYLKRKVCRRRLRL-PMIGDVDVYKCEPWELPeKsVLKSGDKQWYFFSPRDRKYPNGSRSNRTTKHGYWKTTGKDRTISQ 130
                     8*************************999.88**************96357788999************************************99 PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg kktLv+++grap+ge+tdWvmhey+l
  XP_010932189.1 131 -NSKAVGNKKTLVYHRGRAPRGERTDWVMHEYTL 163
                     .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6034186IPR003441NAC domain
PROSITE profilePS5100555.73236186IPR003441NAC domain
PfamPF023651.8E-2737163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MGAAPECRRP TGRSGCDDGI EDEGAVGAAL GNPKCWPPGF RFHPTDEELV LYYLKRKVCR  60
RRLRLPMIGD VDVYKCEPWE LPEKSVLKSG DKQWYFFSPR DRKYPNGSRS NRTTKHGYWK  120
TTGKDRTISQ NSKAVGNKKT LVYHRGRAPR GERTDWVMHE YTLDEQLLMS CNKVQDCYAL  180
YKVFRKSGPG PKNGEQYGAP FREEEWEDDG ENDSSRNQNS KECTASEHPD SATSTGMLGD  240
EGSRLPMDDL EDFLLQLSNE QDIIPQPSKH SAYVSEIDAE AEVGSHTEDQ FRDDEEFLEI  300
KDFNDPESVE WRVDDVSNKD IVHDTGGLYD SYDYFDAPMY LAEEFEPLDG AGQNPYFYED  360
QASHITSELW TFEQDFGVAT AAESNDVIIA PPASGVVYAS TPSNPGENTQ GQISPFGGAS  420
DSWFSSALSS LLDSVPSSPA LASENALISR ALQRVSSFRA GPIGAQEPNG TTGGGTLASG  480
RQRESHNGGF LFISFLVGLV AIFWVLTIGA ALKIFKGLWG KFISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-483716316140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932189.10.0PREDICTED: NAC domain-containing protein 45-like isoform X2
TrEMBLM0U8F70.0M0U8F7_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP11980_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-82NAC domain containing protein 17